PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn319301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 310aa    MW: 34039.7 Da    PI: 8.5714
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn319301genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.7e-1389133347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+  ++ + ++lG+g+W+ Ia+++   Rt+ q+ s+ qky
       Achn319301  89 PWTEDEHRSFLAGLEKLGKGDWRGIAKKFVPSRTPTQVASHAQKY 133
                      8*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.565722IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.21882138IPR017930Myb domain
SuperFamilySSF466896.53E-1784138IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-1785136IPR006447Myb domain, plants
SMARTSM007179.1E-1186136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-1286132IPR009057Homeodomain-like
CDDcd001673.28E-1089134No hitNo description
PfamPF002494.0E-1189133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MVKESARKCS HCGHNGHNSR TCNGKACMKL FGVTIVAQRE DESMRKIKST GDLMACNGEH  60
SALDAGYLSD GLVHSRRDKE AHERKKGVPW TEDEHRSFLA GLEKLGKGDW RGIAKKFVPS  120
RTPTQVASHA QKYFIRLAST DKKKHRSSLF DMSFAEPEIH HSPPQEPLDK STETPQQADN  180
SPPAANMNNF CHTLGQTITS AQVVSPMETP PIFPRPASYG VPDFSHMPYM PLVGGKIVPT  240
VAFVPVMNFP NHGYFYMPKG LGNHATCAPY MSQPPSCFLS LPFPHGPSQA GPETSETKKD  300
SLEFHIGVI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278155.23e-89PREDICTED: transcription factor MYB1R1-like isoform X1
TrEMBLA0A061G0P92e-82A0A061G0P9_THECC; Myb-like transcription factor family protein, putative isoform 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117831823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-64MYB_related family protein